HPA001467

STX7 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001467
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001467, RRID:AB_1857623
Product name
Anti-STX7
Provider product page
Atlas Antibodies - HPA001467
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLG
TPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGS
LPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQ
AAEREKEFVARVRASSRVSGSFPEDSSKERNLVSW
ESQTQPQV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -