Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22933 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22933, RRID:AB_10965687
- Product name
- ZNF488 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ZNF488.
- Antigen sequence
- WRLSEPELGRGCKPVLLEKTNRLGPEAAVGRAGRD
 VGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFT
 ELPRMKDRQVD
- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with ZNF488 polyclonal antibody (Cat # PAB22933) at 1:250-1:500 dilution.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunohistochemical staining of human small intestine with ZNF488 polyclonal antibody (Cat # PAB22933) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)