HPA004114

MRC1 antibody from Sigma-Aldrich
bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004114
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004114, RRID:AB_1846270
Product name
Anti-MRC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004114
Antibody type
Polyclonal
Antigen
Macrophage mannose receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSE
SQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQ
KWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGS
GLWSRWKIYG
Storage
-20C
Provider Type Product Number
- No reagents -