HPA001552

INTS6 antibody from Atlas Antibodies
DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001552
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001552, RRID:AB_1078659
Product name
Anti-INTS6
Provider product page
Atlas Antibodies - HPA001552
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSE
LGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDD
LFKVHKAKPTLKWRQSFESYLKTMPPYYLGPLKKA
VRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKI
ES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -