Antibody data

Product number
ABIN1545102
Provider
antibodies-online
Product name
anti-Chromosome 7 Open Reading Frame 57 (C7ORF57) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545102
Antibody type
Polyclonal
Antigen
The immunogen for Anti-C7orf57 antibody is: synthetic peptide directed towards the C-terminal region of Human C7orf57
Reactivity
Human
Host
Rabbit
Antigen sequence
GQKNSSPTNFSKLISNGYKDEWLQQQQRADSDKRT
PKTSR ASVLSQSPRD
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.