HPA021286

C7orf57 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021286, RRID:AB_1845760
Product name
Anti-C7orf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021286
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf57 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSP
RDLEGPQDAARLQDAEASEGPEDTPGPEESVSAST
PA
Storage
-20C
Provider Type Product Number
- No reagents -