HPA026638

GTF2I antibody from Atlas Antibodies
BAP-135, BTKAP1, DIWS, IB291, SPIN, TFII-I, WBSCR6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026638
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026638, RRID:AB_1857959
Product name
Anti-GTF2I
Provider product page
Atlas Antibodies - HPA026638
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FVIKKHELLNSTREDLQLDKPASGVKEEWYARITK
LRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPN
DLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIK
FVIKRPELLTHSTTEVTQPRTNTPVKEDWNVRIT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -