HPA026638

GTF2I antibody from Sigma-Aldrich
BAP-135, BTKAP1, DIWS, IB291, SPIN, TFII-I, WBSCR6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026638, RRID:AB_1857959
Product name
Anti-GTF2I antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026638
Antibody type
Polyclonal
Antigen
General transcription factor II-I recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVIKKHELLNSTREDLQLDKPASGVKEEWYARITK
LRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPN
DLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIK
FVIKRPELLTHSTTEVTQPRTNTPVKEDWNVRIT
Storage
-20C
Provider Type Product Number
- No reagents -