H00004090-B01

SMAD5 antibody from Abnova Corporation
Dwfc, JV5-1, MADH5

Antibody data

Product number
H00004090-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004090-B01, RRID:AB_1580770
Product name
SMAD5 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00004090-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SMAD5 protein.
Antigen sequence
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAV
DALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPR
SLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELK
PLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVL
VPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPD
SFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSG
PGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSN
NMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELN
NRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLS
NVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD
SSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNN
QEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
SPLNPISSVS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -