HPA003193

SLC6A14 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003193
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003193, RRID:AB_2190122
Product name
Anti-SLC6A14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003193
Antibody type
Polyclonal
Antigen
Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKG
IQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQ
YWNKVALQRSSGMNETG
Storage
-20C
Provider Type Product Number
- No reagents -