HPA021415

MYO19 antibody from MilliporeSigma / Merck KGaA
FLJ22865, MYOHD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021415
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021415, RRID:AB_2266815
Product name
Anti-MYO19 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021415
Antibody type
Polyclonal
Antigen
Myosin-XIX recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTR
VNPVTLETVLRCLQARYMADTFYTNAGCTLVALNP
FKPVPQLYSPELMREYHAAPQPQKLKPHV
Storage
-20C
Provider Type Product Number
- No reagents -