HPA001844

SHC1 antibody from Atlas Antibodies
p66, SHC, ShcA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001844
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001844, RRID:AB_1856826
Product name
Anti-SHC1
Provider product page
Atlas Antibodies - HPA001844
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLRNESLSSLEEGASGSTPPEELPSPSASSLGPIL
PPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSK
GEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSG
GGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHP
NDKVMG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -