HPA001844

SHC1 antibody from Sigma-Aldrich
p66, SHC, ShcA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001844, RRID:AB_1856826
Product name
Anti-SHC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001844
Antibody type
Polyclonal
Antigen
SHC-transforming protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLRNESLSSLEEGASGSTPPEELPSPSASSLGPIL
PPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSK
GEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSG
GGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHP
NDKVMG
Storage
-20C
Provider Type Product Number
- No reagents -