HPA023788

TEFM antibody from Atlas Antibodies
C17orf42, FLJ22729
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023788
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023788, RRID:AB_1848818
Product name
Anti-TEFM
Provider product page
Atlas Antibodies - HPA023788
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRSINIVEHRENFGPFQNLESLMNVPLFKYKSTVQ
VCNSILCPKTGREKRKSPENRFLRKLLKPDIERER
LKAVNSIISIV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -