HPA023788

TEFM antibody from Sigma-Aldrich
C17orf42, FLJ22729
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023788
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023788, RRID:AB_1848818
Product name
Anti-C17orf42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023788
Antibody type
Polyclonal
Antigen
UPF0629 protein C17orf42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRSINIVEHRENFGPFQNLESLMNVPLFKYKSTVQ
VCNSILCPKTGREKRKSPENRFLRKLLKPDIERER
LKAVNSIISIV
Storage
-20C
Provider Type Product Number
- No reagents -