HPA019911

DUSP14 antibody from Atlas Antibodies
MKP-L, MKP6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019911
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019911, RRID:AB_1847888
Product name
Anti-DUSP14
Provider product page
Atlas Antibodies - HPA019911
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVAS
NRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPL
ADMPHAPIGLYFDTVADKIHSVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -