HPA019911

DUSP14 antibody from Sigma-Aldrich
MKP-L, MKP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019911, RRID:AB_1847888
Product name
Anti-DUSP14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019911
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVAS
NRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPL
ADMPHAPIGLYFDTVADKIHSVS
Storage
-20C
Provider Type Product Number
- No reagents -