Antibody data

Product number
H00001527-B03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001527-B03, RRID:AB_1573845
Product name
CXorf2 MaxPab mouse polyclonal antibody (B03)
Provider product page
Abnova Corporation - H00001527-B03
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CXorf2 protein.
Antigen sequence
MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGP
SSLADGGLAHNLQDSVRHRILYLSEQLRVEKASRD
GNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASAT
IAQIEHRLHQCHQQLQELEEGCRPEGLLLMAESDP
ANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFI
LESRFQSLQQGTCLETEDVAQQQNLLLQKVKAELE
EAKRFHISLQESYHSLKERSLTDLQLLLESLQEEK
CRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERM
AYLSYERAKEIWEITETFKSRISKLEMLQQVTQLE
AAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLC
ACPSSLISSRLCTCTMLMLIGLGVLAWQRWRAIPA
TDWQEWVPSRCRLYSKDSGPPADGP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -