HPA001233

PPP4R3B antibody from Sigma-Aldrich
FLFL2, FLJ31474, KIAA1387, PSY2, SMEK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001233
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001233, RRID:AB_1080033
Product name
Anti-SMEK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001233
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase 4 regulatory subunit 3B recombinant protein epitope signature tag (PrEST
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFR
RDAKALEEDEEMWFNEDEEEEGKAVMPPLE
Storage
-20C
Provider Type Product Number
- No reagents -