Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001330 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001330, RRID:AB_1080167
- Product name
- Anti-STX4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLG
SPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIE
PQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK
CNSMQSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Protein expression of PKCZ (Protein Kinase C Zeta), Munc18c, and Syntaxin-4 in the insulin pathway in endometria of patients with polycystic ovary syndrome (PCOS).
Quantitative proteomics reveals that only a subset of the endoplasmic reticulum contributes to the phagosome.
Rivero R, Garin CA, Ormazabal P, Silva A, Carvajal R, Gabler F, Romero C, Vega M
Reproductive biology and endocrinology : RB&E 2012 Mar 5;10:17
Reproductive biology and endocrinology : RB&E 2012 Mar 5;10:17
Quantitative proteomics reveals that only a subset of the endoplasmic reticulum contributes to the phagosome.
Campbell-Valois FX, Trost M, Chemali M, Dill BD, Laplante A, Duclos S, Sadeghi S, Rondeau C, Morrow IC, Bell C, Gagnon E, Hatsuzawa K, Thibault P, Desjardins M
Molecular & cellular proteomics : MCP 2012 Jul;11(7):M111.016378
Molecular & cellular proteomics : MCP 2012 Jul;11(7):M111.016378
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows membranous positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gastrointestinal shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymphoid tissues shows strong membranous positivity in germinal center cells.
- Sample type
- HUMAN
