HPA001330

STX4 antibody from Sigma-Aldrich
p35-2, STX4A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001330
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001330, RRID:AB_1080167
Product name
Anti-STX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001330
Antibody type
Polyclonal
Antigen
Syntaxin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLG
SPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIE
PQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK
CNSMQSE
Storage
-20C
Provider Type Product Number
- No reagents -