Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003704-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003704-M01, RRID:AB_1576424
- Product name
- ITPA monoclonal antibody (M01), clone 2H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ITPA.
- Antigen sequence
KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTG
DPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPD
GYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA- Isotype
- IgG
- Antibody clone number
- 2H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel multiparameter flow cytometric assay for inosine triphosphatase expression analysis in leukocytes.
Vroemen WH, Munnix IC, Bakker JA, Bierau J, Huts M, Leers MP
Cytometry. Part A : the journal of the International Society for Analytical Cytology 2012 Aug;81(8):672-8
Cytometry. Part A : the journal of the International Society for Analytical Cytology 2012 Aug;81(8):672-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ITPA is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol