H00003704-M01

ITPA antibody from Abnova Corporation
C20orf37, dJ794I6.3, HLC14-06-P

Antibody data

Product number
H00003704-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003704-M01, RRID:AB_1576424
Product name
ITPA monoclonal antibody (M01), clone 2H8
Provider product page
Abnova Corporation - H00003704-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ITPA.
Antigen sequence
KWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTG
DPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPD
GYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLA
Isotype
IgG
Antibody clone number
2H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -