HPA023129

HEATR9 antibody from Atlas Antibodies
C17orf66, FLJ32830
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023129
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023129, RRID:AB_1845599
Product name
Anti-HEATR9
Provider product page
Atlas Antibodies - HPA023129
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NKVLSVYEAPKTNVKAEPTRFQKEPENPEELTIQD
FRLAKLNPLFIAKSITKVGQKKTPAFPPCCSKPRK
HRPQVIGPWQPRIKKQL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -