HPA023129

HEATR9 antibody from Sigma-Aldrich
C17orf66, FLJ32830
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023129
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023129, RRID:AB_1845599
Product name
Anti-C17orf66 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023129
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf66 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKVLSVYEAPKTNVKAEPTRFQKEPENPEELTIQD
FRLAKLNPLFIAKSITKVGQKKTPAFPPCCSKPRK
HRPQVIGPWQPRIKKQL
Storage
-20C
Provider Type Product Number
- No reagents -