HPA013699

C17orf78 antibody from Sigma-Aldrich
FLJ39647
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013699
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013699, RRID:AB_1848928
Product name
Anti-C17orf78 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013699
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf78 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPGISQCKVLGASSETFPTTAPSITPGNKEGEKTT
STDTDENLEKRQKWSI
Storage
-20C
Provider Type Product Number
- No reagents -