HPA001384

SYK antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001384, RRID:AB_1080144
Product name
Anti-SYK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001384
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase SYK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATW
SAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVS
FNPYEPELAPWAADKGPQREALPMDTEVYESPYAD
PEEIRPKEVYLDRKLLTLEDKELGSGNF
Storage
-20C
Provider Type Product Number
- No reagents -