HPA000426

IKBKG antibody from Atlas Antibodies
FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000426
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000426, RRID:AB_1851572
Product name
Anti-IKBKG
Provider product page
Atlas Antibodies - HPA000426
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAM
LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILR
ERCEELLHFQASQREEKEFLMCKFQEARKLVERLG
LEKLDLKRQKEQAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -