HPA000426

IKBKG antibody from Sigma-Aldrich
FIP-3, FIP3, Fip3p, IKK-gamma, IP1, IP2, NEMO, ZC2HC9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000426, RRID:AB_1851572
Product name
Anti-IKBKG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000426
Antibody type
Polyclonal
Antigen
NF-kappa-B essential modulator recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAM
LHLPSEQGAPETLQRCLEENQELRDAIRQSNQILR
ERCEELLHFQASQREEKEFLMCKFQEARKLVERLG
LEKLDLKRQKEQAL
Storage
-20C
Provider Type Product Number
- No reagents -