HPA030076

DNAJC28 antibody from Atlas Antibodies
C21orf55, C21orf78
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA030076
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030076, RRID:AB_10602218
Product name
Anti-DNAJC28
Provider product page
Atlas Antibodies - HPA030076
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKK
KIREYYRLLNVEEGCSADEVRESFHKLAKQYHPDS
GSN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -