H00054943-B01

DNAJC28 antibody from Abnova Corporation
C21orf55, C21orf78

Antibody data

Product number
H00054943-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054943-B01, RRID:AB_1137862
Product name
C21orf55 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00054943-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C21orf55 protein.
Antigen sequence
MNTMYVMMAQILRSHLIKATVIPNRVKMLPYFGII
RNRMMSTHKSKKKIREYYRLLNVEEGCSADEVRES
FHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSH
VIEQTNASQSKGEEEEDVEKFKYKTPQHRHYLSFE
GIGFGTPTQREKHYRQFRADRAAEQVMEYQKQKLQ
SQYFPDSVIVKNIRQSKQQKITQAIERLVEDLIQE
SMAKGDFDNLSGKGKRLKKFSDCSYIDPMTHNLNR
ILIDNGYQPEWILKQKEISDTIEQLREAILVSRKK
LGNPMTPTEKKQWNHVCEQFQENIRKLNKRINDFN
CSHPDQAKSPF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -