HPA018003

DNAJC28 antibody from Sigma-Aldrich
C21orf55, C21orf78
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018003
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018003, RRID:AB_1845695
Product name
Anti-DNAJC28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018003
Antibody type
Polyclonal
Antigen
J domain-containing protein C21orf55.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTH
NLNRILIDNGYQPEWILKQKEISDTIEQLREAILV
SRKKLGNPMTPTEKKQWNHVCEQF
Storage
-20C
Provider Type Product Number
- No reagents -