HPA030076

DNAJC28 antibody from MilliporeSigma / Merck KGaA
C21orf55, C21orf78
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030076
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030076, RRID:AB_10602218
Product name
Anti-DNAJC28 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030076
Antibody type
Polyclonal
Antigen
DnaJ (Hsp40) homolog, subfamily C, member 28 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSHLIKATVIPNRVKMLPYFGIIRNRMMSTHKSKK
KIREYYRLLNVEEGCSADEVRESFHKLAKQYHPDS
GSN
Storage
-20C
Provider Type Product Number
- No reagents -