HPA018003

DNAJC28 antibody from Atlas Antibodies
C21orf55, C21orf78
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018003
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018003, RRID:AB_1233621
Product name
Anti-DNAJC28
Provider product page
Atlas Antibodies - HPA018003
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTH
NLNRILIDNGYQPEWILKQKEISDTIEQLREAILV
SRKKLGNPMTPTEKKQWNHVCEQF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -