Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24525 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24525, RRID:AB_11122217
- Product name
- LIX1L polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant LIX1L.
- Antigen sequence
LKAMRERQCSRQEVLAHYSHRALDDDIRHQMALDW
VSREQSVPGALSRELASTERELDEARLAGKELRFH
K- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Novel roles for LIX1L in promoting cancer cell proliferation through ROS1-mediated LIX1L phosphorylation.
Nakamura S, Kahyo T, Tao H, Shibata K, Kurabe N, Yamada H, Shinmura K, Ohnishi K, Sugimura H
Scientific reports 2015 Aug 27;5:13474
Scientific reports 2015 Aug 27;5:13474
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas with LIX1L polyclonal antibody (Cat # PAB24525) shows strong cytoplasmic positivity in pancreatic ducts at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)