HPA001376

FES antibody from Sigma-Aldrich
FPS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001376, RRID:AB_1078847
Product name
Anti-FES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001376
Antibody type
Polyclonal
Antigen
Proto-oncogene tyrosine-protein kinase Fes/Fps recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAH
HNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHE
EMACILKEILQEYLEISSLVQDEVVAIHREMAAAA
ARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEE
GEPLEP
Storage
-20C
Provider Type Product Number
- No reagents -