HPA024447

SLFN12L antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024447
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024447, RRID:AB_1856614
Product name
Anti-SLFN12L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024447
Antibody type
Polyclonal
Antigen
Schlafen family member 12-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPV
SQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTF
CRNLFSQHEGLK
Storage
-20C
Provider Type Product Number
- No reagents -