HPA014850

NEFL antibody from Sigma-Aldrich
CMT1F, CMT2E, NF68, NFL, PPP1R110
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014850
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014850, RRID:AB_1854397
Product name
Anti-NEFL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014850
Antibody type
Polyclonal
Antigen
Neurofilament light polypeptide recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTA
RSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENL
DLSQVAAISNDLKSIRTQEKAQLQDLNDRF
Storage
-20C
Provider Type Product Number
- No reagents -