HPA004021

MLLT6 antibody from Atlas Antibodies
AF17, FLJ23480
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004021
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004021, RRID:AB_1853995
Product name
Anti-MLLT6
Provider product page
Atlas Antibodies - HPA004021
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFST
TTSSSGRARAPSPGDYKSPHVTGSGASAGTHKRMP
ALSATPVPADETPETGLKEKKHKASKRSRHGPGRP
KGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSG
GSLVSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -