HPA004021

MLLT6 antibody from Sigma-Aldrich
AF17, FLJ23480
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004021, RRID:AB_1853995
Product name
Anti-MLLT6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004021
Antibody type
Polyclonal
Antigen
Protein AF-17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFST
TTSSSGRARAPSPGDYKSPHVTGSGASAGTHKRMP
ALSATPVPADETPETGLKEKKHKASKRSRHGPGRP
KGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSG
GSLVSS
Storage
-20C
Provider Type Product Number
- No reagents -