HPA012066

PRAG1 antibody from Atlas Antibodies
DKFZp761P0423, NACK, PEAK2, PRAGMIN, SgK223
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012066
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012066, RRID:AB_1847706
Product name
Anti-PRAG1
Provider product page
Atlas Antibodies - HPA012066
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TNGVAISDPSRCPQPAASSASEQRRPRFQAGTWSR
QCRIEEEEEVEQELLSHSWGRETKNGPTDHSNSTT
WHRLHPTDGSSGQNSKVGTGMSKSASFAFEFPKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -