Antibody data
- Antibody Data
- Antigen structure
- References [29]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055802-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055802-M06, RRID:AB_530021
- Product name
- DCP1A monoclonal antibody (M06), clone 3G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DCP1A.
- Antigen sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVE
ELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPN
SFLPFPFEQLGGAPQSETLGVPSAAHHSVQ- Isotype
- IgG
- Antibody clone number
- 3G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A Smaug2-Based Translational Repression Complex Determines the Balance between Precursor Maintenance versus Differentiation during Mammalian Neurogenesis.
Host cytoplasmic processing bodies assembled by Trypanosoma cruzi during infection exert anti-parasitic activity.
Hepatitis C virus infection inhibits P-body granule formation in human livers.
CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
C9orf72 nucleotide repeat structures initiate molecular cascades of disease.
5-Fluorouracil affects assembly of stress granules based on RNA incorporation.
hnRNP L and NF90 interact with hepatitis C virus 5'-terminal untranslated RNA and promote efficient replication.
The P body protein Dcp1a is hyper-phosphorylated during mitosis.
Pdc1 functions in the assembly of P bodies in Schizosaccharomyces pombe.
Identification and analysis of a novel dimerization domain shared by various members of c-Jun N-terminal kinase (JNK) scaffold proteins.
Zinc-finger antiviral protein mediates retinoic acid inducible gene I-like receptor-independent antiviral response to murine leukemia virus.
Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication.
Identification of DEAD-box RNA helicase 6 (DDX6) as a cellular modulator of vascular endothelial growth factor expression under hypoxia.
Multiple mechanisms repress N-Bak mRNA translation in the healthy and apoptotic neurons.
A monoclonal antibody against p53 cross-reacts with processing bodies.
PKCα binds G3BP2 and regulates stress granule formation following cellular stress.
BUHO: a MATLAB script for the study of stress granules and processing bodies by high-throughput image analysis.
Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection.
The NS1 protein of influenza A virus interacts with cellular processing bodies and stress granules through RNA-associated protein 55 (RAP55) during virus infection.
The DEAD-box RNA helicase DDX6 is required for efficient encapsidation of a retroviral genome.
Differential utilization of decapping enzymes in mammalian mRNA decay pathways.
Smaug1 mRNA-silencing foci respond to NMDA and modulate synapse formation.
c-Jun N-terminal kinase phosphorylates DCP1a to control formation of P bodies.
A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation.
NANOS2 interacts with the CCR4-NOT deadenylation complex and leads to suppression of specific RNAs.
A large ribonucleoprotein particle induced by cytoplasmic PrP shares striking similarities with the chromatoid body, an RNA granule predicted to function in posttranscriptional gene regulation.
Cytoplasmic compartmentalization of the fetal piRNA pathway in mice.
The dynamics of mammalian P body transport, assembly, and disassembly in vivo.
Amadei G, Zander MA, Yang G, Dumelie JG, Vessey JP, Lipshitz HD, Smibert CA, Kaplan DR, Miller FD
The Journal of neuroscience : the official journal of the Society for Neuroscience 2015 Nov 25;35(47):15666-81
The Journal of neuroscience : the official journal of the Society for Neuroscience 2015 Nov 25;35(47):15666-81
Host cytoplasmic processing bodies assembled by Trypanosoma cruzi during infection exert anti-parasitic activity.
Seto E, Onizuka Y, Nakajima-Shimada J
Parasitology international 2015 Dec;64(6):540-6
Parasitology international 2015 Dec;64(6):540-6
Hepatitis C virus infection inhibits P-body granule formation in human livers.
Pérez-Vilaró G, Fernández-Carrillo C, Mensa L, Miquel R, Sanjuan X, Forns X, Pérez-del-Pulgar S, Díez J
Journal of hepatology 2015 Apr;62(4):785-90
Journal of hepatology 2015 Apr;62(4):785-90
CCHCR1 interacts with EDC4, suggesting its localization in P-bodies.
Ling YH, Wong CC, Li KW, Chan KM, Boukamp P, Liu WK
Experimental cell research 2014 Sep 10;327(1):12-23
Experimental cell research 2014 Sep 10;327(1):12-23
C9orf72 nucleotide repeat structures initiate molecular cascades of disease.
Haeusler AR, Donnelly CJ, Periz G, Simko EA, Shaw PG, Kim MS, Maragakis NJ, Troncoso JC, Pandey A, Sattler R, Rothstein JD, Wang J
Nature 2014 Mar 13;507(7491):195-200
Nature 2014 Mar 13;507(7491):195-200
5-Fluorouracil affects assembly of stress granules based on RNA incorporation.
Kaehler C, Isensee J, Hucho T, Lehrach H, Krobitsch S
Nucleic acids research 2014 Jun;42(10):6436-47
Nucleic acids research 2014 Jun;42(10):6436-47
hnRNP L and NF90 interact with hepatitis C virus 5'-terminal untranslated RNA and promote efficient replication.
Li Y, Masaki T, Shimakami T, Lemon SM
Journal of virology 2014 Jul;88(13):7199-209
Journal of virology 2014 Jul;88(13):7199-209
The P body protein Dcp1a is hyper-phosphorylated during mitosis.
Aizer A, Kafri P, Kalo A, Shav-Tal Y
PloS one 2013;8(1):e49783
PloS one 2013;8(1):e49783
Pdc1 functions in the assembly of P bodies in Schizosaccharomyces pombe.
Wang CY, Chen WL, Wang SW
Molecular and cellular biology 2013 Mar;33(6):1244-53
Molecular and cellular biology 2013 Mar;33(6):1244-53
Identification and analysis of a novel dimerization domain shared by various members of c-Jun N-terminal kinase (JNK) scaffold proteins.
Cohen-Katsenelson K, Wasserman T, Darlyuk-Saadon I, Rabner A, Glaser F, Aronheim A
The Journal of biological chemistry 2013 Mar 8;288(10):7294-304
The Journal of biological chemistry 2013 Mar 8;288(10):7294-304
Zinc-finger antiviral protein mediates retinoic acid inducible gene I-like receptor-independent antiviral response to murine leukemia virus.
Lee H, Komano J, Saitoh Y, Yamaoka S, Kozaki T, Misawa T, Takahama M, Satoh T, Takeuchi O, Yamamoto N, Matsuura Y, Saitoh T, Akira S
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 23;110(30):12379-84
Proceedings of the National Academy of Sciences of the United States of America 2013 Jul 23;110(30):12379-84
Competing and noncompeting activities of miR-122 and the 5' exonuclease Xrn1 in regulation of hepatitis C virus replication.
Li Y, Masaki T, Yamane D, McGivern DR, Lemon SM
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):1881-6
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):1881-6
Identification of DEAD-box RNA helicase 6 (DDX6) as a cellular modulator of vascular endothelial growth factor expression under hypoxia.
de Vries S, Naarmann-de Vries IS, Urlaub H, Lue H, Bernhagen J, Ostareck DH, Ostareck-Lederer A
The Journal of biological chemistry 2013 Feb 22;288(8):5815-27
The Journal of biological chemistry 2013 Feb 22;288(8):5815-27
Multiple mechanisms repress N-Bak mRNA translation in the healthy and apoptotic neurons.
Jakobson M, Jakobson M, Llano O, Palgi J, Arumäe U
Cell death & disease 2013 Aug 22;4:e777
Cell death & disease 2013 Aug 22;4:e777
A monoclonal antibody against p53 cross-reacts with processing bodies.
Thomas MG, Luchelli L, Pascual M, Gottifredi V, Boccaccio GL
PloS one 2012;7(5):e36447
PloS one 2012;7(5):e36447
PKCα binds G3BP2 and regulates stress granule formation following cellular stress.
Kobayashi T, Winslow S, Sunesson L, Hellman U, Larsson C
PloS one 2012;7(4):e35820
PloS one 2012;7(4):e35820
BUHO: a MATLAB script for the study of stress granules and processing bodies by high-throughput image analysis.
Perez-Pepe M, Slomiansky V, Loschi M, Luchelli L, Neme M, Thomas MG, Boccaccio GL
PloS one 2012;7(12):e51495
PloS one 2012;7(12):e51495
Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
Osugi K, Suzuki H, Nomura T, Ariumi Y, Shibata H, Maki M
Journal of biochemistry 2012 Jun;151(6):657-66
Journal of biochemistry 2012 Jun;151(6):657-66
LSm14A is a processing body-associated sensor of viral nucleic acids that initiates cellular antiviral response in the early phase of viral infection.
Li Y, Chen R, Zhou Q, Xu Z, Li C, Wang S, Mao A, Zhang X, He W, Shu HB
Proceedings of the National Academy of Sciences of the United States of America 2012 Jul 17;109(29):11770-5
Proceedings of the National Academy of Sciences of the United States of America 2012 Jul 17;109(29):11770-5
The NS1 protein of influenza A virus interacts with cellular processing bodies and stress granules through RNA-associated protein 55 (RAP55) during virus infection.
Mok BW, Song W, Wang P, Tai H, Chen Y, Zheng M, Wen X, Lau SY, Wu WL, Matsumoto K, Yuen KY, Chen H
Journal of virology 2012 Dec;86(23):12695-707
Journal of virology 2012 Dec;86(23):12695-707
The DEAD-box RNA helicase DDX6 is required for efficient encapsidation of a retroviral genome.
Yu SF, Lujan P, Jackson DL, Emerman M, Linial ML
PLoS pathogens 2011 Oct;7(10):e1002303
PLoS pathogens 2011 Oct;7(10):e1002303
Differential utilization of decapping enzymes in mammalian mRNA decay pathways.
Li Y, Song M, Kiledjian M
RNA (New York, N.Y.) 2011 Mar;17(3):419-28
RNA (New York, N.Y.) 2011 Mar;17(3):419-28
Smaug1 mRNA-silencing foci respond to NMDA and modulate synapse formation.
Baez MV, Luchelli L, Maschi D, Habif M, Pascual M, Thomas MG, Boccaccio GL
The Journal of cell biology 2011 Dec 26;195(7):1141-57
The Journal of cell biology 2011 Dec 26;195(7):1141-57
c-Jun N-terminal kinase phosphorylates DCP1a to control formation of P bodies.
Rzeczkowski K, Beuerlein K, Müller H, Dittrich-Breiholz O, Schneider H, Kettner-Buhrow D, Holtmann H, Kracht M
The Journal of cell biology 2011 Aug 22;194(4):581-96
The Journal of cell biology 2011 Aug 22;194(4):581-96
A novel c-Jun N-terminal kinase (JNK)-binding protein WDR62 is recruited to stress granules and mediates a nonclassical JNK activation.
Wasserman T, Katsenelson K, Daniliuc S, Hasin T, Choder M, Aronheim A
Molecular biology of the cell 2010 Jan 1;21(1):117-30
Molecular biology of the cell 2010 Jan 1;21(1):117-30
NANOS2 interacts with the CCR4-NOT deadenylation complex and leads to suppression of specific RNAs.
Suzuki A, Igarashi K, Aisaki K, Kanno J, Saga Y
Proceedings of the National Academy of Sciences of the United States of America 2010 Feb 23;107(8):3594-9
Proceedings of the National Academy of Sciences of the United States of America 2010 Feb 23;107(8):3594-9
A large ribonucleoprotein particle induced by cytoplasmic PrP shares striking similarities with the chromatoid body, an RNA granule predicted to function in posttranscriptional gene regulation.
Beaudoin S, Vanderperre B, Grenier C, Tremblay I, Leduc F, Roucou X
Biochimica et biophysica acta 2009 Feb;1793(2):335-45
Biochimica et biophysica acta 2009 Feb;1793(2):335-45
Cytoplasmic compartmentalization of the fetal piRNA pathway in mice.
Aravin AA, van der Heijden GW, Castañeda J, Vagin VV, Hannon GJ, Bortvin A
PLoS genetics 2009 Dec;5(12):e1000764
PLoS genetics 2009 Dec;5(12):e1000764
The dynamics of mammalian P body transport, assembly, and disassembly in vivo.
Aizer A, Brody Y, Ler LW, Sonenberg N, Singer RH, Shav-Tal Y
Molecular biology of the cell 2008 Oct;19(10):4154-66
Molecular biology of the cell 2008 Oct;19(10):4154-66
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DCP1A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DCP1A on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol