HPA018120

SLC4A11 antibody from MilliporeSigma / Merck KGaA
BTR1, CDPD1, CHED2, dJ794I6.2, FECD4, NaBC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018120
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018120, RRID:AB_1857186
Product name
Anti-SLC4A11 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018120
Antibody type
Polyclonal
Antigen
Sodium bicarbonate transporter-like protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHR
DLDGFLAQASIVLNETATSLDNVLRTMLRRFARDP
DNNEPNCNLDLLMAMLFTDAGAPMRGKVHLL
Storage
-20C
Provider Type Product Number
- No reagents -