HPA016583

ORAI1 antibody from Sigma-Aldrich
CRACM1, FLJ14466, TMEM142A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016583
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016583, RRID:AB_1848720
Product name
Anti-ORAI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016583
Antibody type
Polyclonal
Antigen
Calcium release-activated calcium channel protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPL
TPGSHYA
Storage
-20C
Provider Type Product Number
- No reagents -