ABIN1545524
antibody from antibodies-online
Targeting: CCL16
CKb12, HCC-4, LCC-1, LEC, LMC, Mtn-1, NCC-4, SCYA16, SCYL4
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1545524 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-C Motif) Ligand 16 (CCL16) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human CCL16
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNS
EEVRL RSFTTTIHKV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genome-wide scan for visceral leishmaniasis susceptibility genes in Brazil.
Jamieson SE, Miller EN, Peacock CS, Fakiola M, Wilson ME, Bales-Holst A, Shaw MA, Silveira F, Shaw JJ, Jeronimo SM, Blackwell JM
Genes and immunity 2007 Jan;8(1):84-90
Genes and immunity 2007 Jan;8(1):84-90
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- CCL16 (chemokine (C-C motif) ligand 16) Antibody (against the middle region of CCL16) (541 μg) validated by WB using Fetal heart lysate at 0.2-1 μg/mL.