HPA015498

GDF10 antibody from Sigma-Aldrich
BMP-3b
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015498
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015498, RRID:AB_1849584
Product name
Anti-GDF10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015498
Antibody type
Polyclonal
Antigen
Bone morphogenetic protein 3b precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISEPNSVAVTLQRYDPFPAGDPEPRAAPNNSADPR
VRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQ
LWPSPFRALKPRPGRKDRRKKGQEVFMAASQVLDF
DEKTMQKA
Storage
-20C
Provider Type Product Number
- No reagents -