Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000027-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000027-M03, RRID:AB_565433
- Product name
- ABL2 monoclonal antibody (M03), clone 6D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ABL2.
- Antigen sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLP
EQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVD
RANDMLPKKSEESAAPSRERPKAKLLPRGA- Isotype
- IgG
- Antibody clone number
- 6D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ABL2 monoclonal antibody (M03), clone 6D5. Western Blot analysis of ABL2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ABL2 expression in transfected 293T cell line by ABL2 monoclonal antibody (M03), clone 6D5.Lane 1: ABL2 transfected lysate(126.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ABL2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between NCK1 and ABL2. HeLa cells were stained with anti-NCK1 rabbit purified polyclonal 1:1200 and anti-ABL2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)