HPA001866

ABL2 antibody from Sigma-Aldrich
ABLL, ARG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001866, RRID:AB_1078082
Product name
Anti-ABL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001866
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase ABL2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLI
SPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSG
DKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEE
PTALTAGQSTSETQEGGKKAALGAVPISGKA
Storage
-20C
Provider Type Product Number
- No reagents -