HPA002063

GABRQ antibody from Sigma-Aldrich
THETA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002063
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002063, RRID:AB_1078932
Product name
Anti-GABRQ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002063
Antibody type
Polyclonal
Antigen
gamma-Aminobutyric-acid receptor subunit theta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGVSSLPITPAQAPLASPESLGSLTSTSEQAQLAT
SESLSPLTSLSGQAPLATGESLSDLPSTSEQARHS
YGVRFNGFQADDSIFPTEIRNRVEAHGHGVTHDHE
DSNESLSSDE
Storage
-20C
Provider Type Product Number
- No reagents -