Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [4]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000126-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000126-D01, RRID:AB_10717208
- Product name
- ADH1C MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ADH1C protein.
- Antigen sequence
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAH
EVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICK
NPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH
FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGC
GFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQ
DYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL
LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTW
KGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI
LPFEKINEGFDLLRSGKSIRTVLTF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ADH1C expression in transfected 293T cell line (H00000126-T01) by ADH1C MaxPab polyclonal antibody.Lane 1: ADH1C transfected lysate(39.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ADH1C MaxPab rabbit polyclonal antibody. Western Blot analysis of ADH1C expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ADH1C MaxPab rabbit polyclonal antibody. Western Blot analysis of ADH1C expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ADH1C MaxPab rabbit polyclonal antibody. Western Blot analysis of ADH1C expression in mouse liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ADH1C transfected lysate using anti-ADH1C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ADH1C purified MaxPab mouse polyclonal antibody (B01P) (H00000126-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol