H00006358-M01
antibody from Abnova Corporation
Targeting: CCL14
CKb1, HCC-1, HCC-3, MCIF, NCC-2, SCYA14, SCYL2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006358-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006358-M01, RRID:AB_489732
- Product name
- CCL14 monoclonal antibody (M01), clone 1F12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCL14.
- Antigen sequence
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYE
TNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKD
MKEN- Isotype
- IgG
- Antibody clone number
- 1F12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.Lane 1: CCL14 transfected lysate(10.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol